PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc06524.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 270aa    MW: 29358.9 Da    PI: 10.0767
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc06524.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.9e-172774148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  rg+W++eEdell + v++ G g+W+t +r+ g+ R++k+c++rw +yl
  Zmw_sc06524.1.g00050.1.sm.mk 27 RGPWSPEEDELLSRFVAREGEGRWRTLPRRAGLLRCGKSCRLRWMNYL 74
                                  89******************************99************97 PP

2Myb_DNA-binding43.11e-1381139248
                                   SSS-HHHHHHHHHHHHHTTTT.............-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   2 grWTteEdellvdavkqlGgg.............tWktIartmgkgRtlkqcksrwqkyl 48 
                                   g+  ++E++l+++++++lG++             +W++Ia +++ gRt++++k++w+++l
  Zmw_sc06524.1.g00050.1.sm.mk  81 GPIAADEEDLILRLHRLLGNRfilarvrartrarRWSLIAGRLP-GRTDNEIKNYWNSHL 139
                                   566689**************************************.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.2142278IPR017930Myb domain
SuperFamilySSF466891.02E-2325135IPR009057Homeodomain-like
SMARTSM007179.8E-132676IPR001005SANT/Myb domain
PfamPF002498.7E-152774IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-212881IPR009057Homeodomain-like
CDDcd001671.00E-102974No hitNo description
SMARTSM007175.0E-1179141IPR001005SANT/Myb domain
PROSITE profilePS5129414.22279143IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.2E-2282143IPR009057Homeodomain-like
PfamPF002497.4E-1284139IPR001005SANT/Myb domain
CDDcd001671.98E-885139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0010468Biological Processregulation of gene expression
GO:0048354Biological Processmucilage biosynthetic process involved in seed coat development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MTRKQPAAVV RRRGGGGGAA AVAALKRGPW SPEEDELLSR FVAREGEGRW RTLPRRAGLL  60
RCGKSCRLRW MNYLRPDIKR GPIAADEEDL ILRLHRLLGN RFILARVRAR TRARRWSLIA  120
GRLPGRTDNE IKNYWNSHLS KKLLAQGIDP RTHRPLHAAH NSNSNANSKK PCVSPPPPSA  180
STSGAGVAGE DGGSDFAAAM GLDADGFNGF GDEFRACWDA PCAGFDLGFA TVDDATFSSF  240
LDSLISEDQF VDYFGDHNNA SGGKDQGSAS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-22221432108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008656780.11e-100PREDICTED: transcription repressor MYB5-like
SwissprotQ388502e-72MYB5_ARATH; Transcription repressor MYB5
TrEMBLK7V4P01e-99K7V4P0_MAIZE; Putative MYB DNA-binding domain superfamily protein
STRINGGRMZM2G395672_P013e-99(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448